Journal of Animal Science and Technology
Korean Society of Animal Sciences and Technology
RESEARCH ARTICLE

Multilocus sequence type-dependent activity of human and animal cathelicidins against community-, hospital-, and livestock-associated methicillin-resistant Staphylococcus aureus isolates

Sun Do Kim1,#https://orcid.org/0000-0003-1394-3844, Geun-Bae Kim1,#https://orcid.org/0000-0001-8531-1104, Gi Yong Lee1https://orcid.org/0000-0001-5308-0065, Soo-Jin Yang2,*https://orcid.org/0000-0003-3253-8190
1Department of Animal Science and Technology, Chung-Ang University, Anseong 17546, Korea
2Department of Veterinary Microbiology, College of Veterinary Medicine and Research Institute for Veterinary Science, Seoul National University, Seoul 08826, Korea
*Corresponding author: Soo-Jin Yang, Department of Veterinary Microbiology, College of Veterinary Medicine and Research Institute for Veterinary Science, Seoul National University, Seoul 08826, Korea. Tel: +82-2-880-1185, E-mail: soojinjj@snu.ac.kr

These authors contributed equally to this work.

© Copyright 2022 Korean Society of Animal Science and Technology. This is an Open-Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/4.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.

Received: Feb 24, 2022; Revised: Apr 20, 2022; Accepted: Apr 27, 2022

Published Online: May 31, 2022

Abstract

Sequence type (ST) 5 methicillin-resistant Staphylococcus aureus (MRSA) with staphylococcal cassette chromosome mec (SCCmec) type II (ST5-MRSA-II) and ST72-MRSA-IV represent the most significant genotypes for healthcare- (HA) and community-associated (CA) MRSA in Korea, respectively. In addition to the human-type MRSA strains, the prevalence of livestock-associated (LA) MRSA clonal lineages, such as ST541 and ST398 LA-MRSA-V in pigs and ST692 LA-MRSA-V and ST188 LA-MRSA-IV in chickens, has recently been found. In this study, clonotype-specific resistance profiles to cathelicidins derived from humans (LL-37), pigs (PMAP-36), and chickens (CATH-2) were examined using six different ST groups of MRSA strains: ST5 HA-MRSA-II, ST72 CA-MRSA-IV, ST398 LA-MRSA-V, ST541 LA-MRSA-V, ST188 LA-MRSA-IV, and ST692 LA-MRSA-V. Phenotypic characteristics often involved in cathelicidin resistance, such as net surface positive charge, carotenoid production, and hydrogen peroxide susceptibility were also determined in the MRSA strains. Human- and animal-type MRSA strains exhibited clonotype-specific resistance profiles to LL-37, PMAP-36, or CATH-2, indicating the potential role of cathelicidin resistance in the adaptation and colonization of human and animal hosts. The ST5 HA-MRSA isolates showed enhanced resistance to all three cathelicidins and hydrogen peroxide than ST72 CA-MRSA isolates by implementing increased surface positive charge and carotenoid production. In contrast, LA-MRSA strains employed mechanisms independent of surface charge regulation and carotenoid production for cathelicidin resistance. These results suggest that human- and livestock-derived MRSA strains use different strategies to counteract the bactericidal action of cathelicidins during the colonization of their respective host species.

Keywords: Methicillin-resistant Staphylocuccus aureus; Community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA); Healthcare-associated methicillin-resistant Staphylococcus aureus (HA-MRSA); Livestock-associated methicillin-resistant Staphylococcus aureus (LA-MRSA); Cathelicidin; Host adaptation

INTRODUCTION

Staphylococcus aureus is a commensal organism and opprtunistic pathogen frequently carried asymptomatically on the skin and mucous membranes of human and animal. Mechicillin-resistant S. aureus (MRSA) acquired resistance to methicillin and nearly all β-lactam antibiotics such as cephalosporins as a result of mecA or mecC gene acquisition [1]. Mostly, MRSA strains harbor the mecA within a large mobile genetic element known as staphylococcal casette chromosome mec (SCCmec) [2]. Besides the resistance to β-lactam antibiotics, MRSA usually exhibits multidrug resistance (MDR) phenotypes, and serious infections with such MRSA strains result in significantly enhanced morbidity and mortality [3,4].

MRSA has been known to be widespread and common, but specific genetic lineages can vary depending on geographical regions and host species [5,6]. MRSA strains adapted to humans have usually been divided into healthcare-associated (HA) and community-associated (CA) MRSA. Although the distinctions between the two groups of MRSA strains are becoming obscure, HA-MRSA and CA-MRSA have mainly been recognized in hopitalized patients and non-hospitalized population, respectively. In Korea, sequence type (ST) 5 MRSA with SCCmec type II (ST5-MRSA-II) and ST72-MRSA-IV represent the most significant clonal lineages for (HA- and CA- MRSA, respectively [7–9]. In addition to the human-adapted strains, colonization or infection with livestock-associated (LA) MRSA has been reported in several domesticated livestock animals [1,6,10]. These carrier animals not only serve as reservoirs for opportunistic infections in themselves but also can transmit LA-MRSA to other animal species or humans [10]. In this sense, the recent emergence of ST398 LA-MRSA-V and ST541 LA-MRSA-V in pigs and pig farm environments has posed a serious public health concern worldwide [11–14]. In fact, it has been reported that human workers were colonized with ST398 MRSA shortly after direct or indirect contact with pigs or carcasses in pig farms or slaughterhouses [12]. Although there is limited information on MRSA in poultry, previous studies identified two important clonal lineages of LA-MRSA strains, ST692 LA-MRSA-V and ST188 LA-MRSA-IV, in chickens, chicken carcasses, and slaughterhouse workers in Korea [15,16]. Although various types of MRSA clonal lineages, including both human- and livestock-adapted MRSA strains, have been found in humans and animals, factors affecting the transmission of human-type MRSA lineages to animals or LA-MRSA to humans are poorly understood.

One of the crucial factors in host innate immune reactions against MRSA infection or colonization is the host defense cationic antimicrobial peptide (HD-CAP) [17]. The successful transmission and adaptation of MRSA in a new host species inevitably require the ability to overcome the bactericidal action of HD-CAPs from new hosts [18–20]. Cathelicidins are small, positively charged antimicrobial peptides that constitute a unique family of HD-CAPs. Cathelicidins have been identified in neutrophils, natural killer cells, and the epithelial cells in the skin, respiratory, and gastrointestinal tracts of humans and various animals [21]. Thus, a better understanding of the potential differences in bactericidal activities of human- and animal-originated cathelicidins against human- or animal-adapted MRSA strains will facilitate new insight into host species-specific prevalence of MRSA clonotypes.

In this investigation, potential clonotype-specific resistance profiles to cathelicidins in humans (LL-37), pigs (PMAP-36), and chickens (CATH-2) were determined using six different MRSA strains derived from humans (ST5 HA-MRSA-II and ST72 CA-MRSA-IV), pigs (ST398 LA-MRSA-V and ST541 LA-MRSA-V), and chickens (ST692 LA-MRSA-V and ST188 LA-MRSA-IV). In addition, the net surface positive charges, carotenoid production, and hydrogen peroxide (H2O2) resistance profiles of the MRSA strains were analyzed to identify phenotypic determinants linked to cathelicidin resistance.

MATERIALS AND METHODS

MRSA strains and identification

A total of 45 MRSA isolates of human and animal origin were used in this investigation (Table 1). All human isolates were selected from two previous studies from our laboratory: eight ST5 HA-MRSA and eleven ST72 CA-MRSA isolates [22,23]. Nine ST398 LA-MRSA and six ST541 LA-MRSA isolates were selected from a previous investigation of LA-MRSA in healthy pigs [11]. Six ST692 LA-MRSA and six ST188 LA-MRSA isolates from healthy broiler chickens were selected and obtained from the national surveillance of antimicrobial resistance in livestock performed during 2018-2019 by the Korean Centers for Disease Control and Prevention. This study was conducted under protocols approved by the Institutional Animal Care and the Use Committee of Chunag-Ang University, Anseong, Korea (Approval No. 2018-00112).

Table 1. Genotype and antimicrobial resistance profiles of MRSA strains used in this study
MLST Strain ID spa SCCmec agr Antimicrobial resistance profiles OX MIC (μg/mL)
ST5 (n = 8) HA1 t002 II II AMP-CIP-CLI-ERY-FOX-PEN 512
HA2 t601 II II AMP-CIP-CLI-ERY-FOX-PEN 512
HA3 t2460 II II AMP-CIP-CLI-ERY-FOX-FUS-GEN-PEN-RIF 512
HA4 t2460 II II AMP-CIP-CLI-ERY-FOX-FUS-GEN-PEN 512
HA5 t002 II II AMP-CIP-CLI-ERY-FOX-FUS-GEN-PEN 512
HA6 t601 II II AMP-CIP-CLI-ERY-FOX-PEN 512
HA7 t2460 II II AMP-CIP-CLI-ERY-FOX-FUS-PEN-RIF 512
HA8 t601 II II AMP-CIP-CLI-ERY-FOX-PEN 512
ST72 (n = 11) CA1 t324 IV I AMP-ERY-FOX-PEN 32
CA2 t13921 IV I AMP-FOX-PEN 64
CA3 t664 IV I AMP-FOX-PEN 64
CA4 t2461 IV I AMP-FOX-PEN 32
CA5 t324 IV I AMP-ERY-FOX-PEN 64
CA6 t148 IV I AMP-FOX-PEN 32
CA7 t324 IV I AMP-FOX-PEN 32
CA8 t324 IV I AMP-FOX-PEN 32
CA9 t324 IV I AMP-ERY-FOX-PEN-RIF 64
CA10 t664 IV I AMP-FOX-PEN 32
CA11 t664 IV I AMP-FOX-PEN 32
ST398 (n = 8) Pig1 t571 V I AMP-CHL-CIP-FOX-FUS-PEN-TET 24
Pig2 t18103 V I AMP-CHL-CIP-CLI-ERY-FOX-GEN-PEN-SYN-TET 4
Pig3 t18103 V I AMP-CHL-CIP-CLI-ERY-FOX-GEN-PEN-SYN-TET 4
Pig4 t18103 V I AMP-CHL-CIP-CLI-ERY-FOX-GEN-PEN-SYN-TET 8
Pig5 t18102 V I AMP-CHL-CIP-FOX-PEN-TET 24
Pig6 t18102 V I AMP-CHL-CIP-FOX-PEN-TET 16
Pig7 t18102 V I AMP-CHL-CIP-FOX-PEN-TET 16
Pig8 t18102 V I AMP-CHL-CIP-FOX-PEN-TET 16
ST541 (n = 6) Pig9 t034 V I AMP-CLI-ERY-FOX-PEN-TET 32
Pig10 t034 V I AMP-CLI-ERY-FOX-PEN-TET 12
Pig11 t034 V I AMP-CLI-ERY-FOX-PEN-TET 16
Pig12 t034 V I AMP-CLI-ERY-FOX-PEN-TET 16
Pig13 t034 V I AMP-CLI-ERY-FOX-PEN-TET 16
Pig14 t034 V I AMP-CLI-ERY-FOX-PEN-TET 16
ST692 (n = 6) Chicken1 t2247 V I AMP-CIP-CLI-ERY-FOX-PEN-TET 128
Chicken2 t2247 V I AMP-CIP-CLI-ERY-FOX-FUS-PEN-TET 256
Chicken3 t2247 V I AMP-CIP-CLI-ERY-FOX-PEN-TET 256
Chicken4 t2247 V I AMP-CIP-CLI-ERY-FOX-PEN-TET 128
Chicken5 t2247 V I AMP-CIP-CLI-ERY-FOX-PEN-TET 64
Chicken6 t2247 V I AMP-CIP-CLI-ERY-FOX-PEN-TET 32
ST188 (n = 6) Chicken7 t189 IV I AMP-CIP-CLI-ERY-FOX-GEN-PEN-SXT 128
Chicken8 t189 IV I AMP-CIP-CLI-ERY-FOX-GEN-PEN-SXT 128
Chicken9 t189 IV I AMP-CIP-CLI-ERY-FOX-GEN-PEN-SXT 128
Chicken10 t189 IV I AMP-CIP-CLI-ERY-FOX-GEN-PEN-SXT 128
Chicken11 t189 IV I AMP-CIP-CLI-ERY-FOX-GEN-PEN-SXT 128
Chicken12 t189 IV I AMP-CIP-CLI-ERY-FOX-GEN-PEN-SXT 128

MRSA, methicillin-resistant Staphylococcus aureus; MLST, multilocus sequence typing; SCCmec, staphylococcal cassette chromosome mec; OX, oxacillin; MIC, minimum inhibitory concentration; ST, sequence type; HA, halthcare-associated; AMP, ampicillin; CIP, ciprofloxacin; CLI, clindamycin; ERY, erythromycin; FOX, cefoxitin; PEN, penicillin; FUS, fusidic acid; GEN, gentamicin; RIF, rifampicin; CA, community-associated; CHL, chloramphenicol; TET, tetracycline; SYN, quinupristin-dalfopristin; SXT, sulfamethoxazole-trimethoprim.

Download Excel Table

For isolation of MRSA, swab samples were inoculated into 4 mL of tryptic soy broth (TSB; Difco Laboratories, Detroit, MI, USA) containing 10% NaCl and incubated 18–20 h at 37°C with shaking at 200 rpm. Next, 20 μL of the enriched cultures were streaked onto chromID MRSA SMART agar (bioMérieux, Marcy-l’Étoile, France), then grown for 18–20 h at 37°C. Suspected MRSA colonies from each sample were selected and subcultured on tryptic soy agar (Difco Laboratories) for further identification. To confirm if they were indeed S. aureus, all 45 isolates were subjected to 16S ribosomal RNA sequencing [24] and matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF; Microflex, Daltonics Bruker, Bremen, Germany). Briefly, presumptive S. aureus colonies were applied onto the matrix and the samples were then ionized in an autmated mode with a laser beam in the MALDI-Biotyper Realtime Classification system. The peptide mass fingerprints of bacterial samples were used to identify S. aureus (score values of ≥ 2.0) based on the spectral database (MALDI Biotyper 3.1). All identified MRSA isolates were then grown in Mueller-Hinton broth (Difco Laboratories) or TSB (Difco Laboratories), depending on each experiment.

Determination of antimicrobial susceptibility

The antimicrobial susceptibility of MRSA isolates was examined using the standard disc diffusion assay according to the 2018 Clinical and Laboratory Standards Institute (CLSI) guidelines [25]. The 13 antimicrobial drugs used in the disc diffusion assays were ampicillin (AMP, 10 μg), cefoxitin (FOX, 30 μg), penicillin (PEN, 10 μg), gentamicin (GEN, 10 μg), clindamycin (CLI, 2 μg), chloramphenicol (CHL, 30 μg), erythromycin (ERY, 15 μg), mupirocin (MUP, 200 μg), sulfamethoxazole-trimethoprim (SXT, 23.75/1.25 μg), rifampicin (RIF, 5 μg), quinupristin-dalfopristin (SYN, 15 μg), tetracycline (TET, 30 μg), and ciprofloxacin (CIP, 5 μg). Mupirocin discs were obtained from Oxoid (Hampshire, UK), and the remaining antimicrobial discs were purchased from BD BBLTM (Becton Dickinson, Franklin Lakes, NJ, USA). A standard E-test® (bioMérieux) method was used to determined the minimum inhibitory concentrations (MICs) of oxacillin (OXA) according to the manufacturer’s protocol. The MIC values of MRSA isolates were determined according to the CLSI M100 and VET08 documents [26,27]. Two reference strains, S. aureus MW2 and S. aureus ATCC® 29213, were included in the antimicrobial susceptibility assays.

Molecular characterization of MRSA isolates

All confirmed MRSA strains were subjected to multilocus sequence typing (MLST) as described before [28]. MLST has widely been accepted for a moleuclar epidemiological method of sequence-based typing in S. aureus, which analyzes seven relatively conserved houskeeping genes that encode essential proteins. The seven target loci (aroE, arcC, glpF, tpi, gmk, pta, and yqiL) were amplified via polymerase chain reaction (PCR) and sequenced. The STs were then determined as suggested in the MLST database (http://pubmlst.org/saureus/) [28]. The allelic profiles of each STs of MRSA strains were: ST5 (1-4-1-4-12-1-10), ST72 (1-4-1-8-4-4-3), ST398 (3-35-19-2-20-26-39), ST541 (3-35-19-60-20-26-39), ST692 (12-89-1-1-4-5-90), and ST188 (3-1-1-8-1-1-1). The types of SCCmec were determined through a series of multiplex PCR analyses, as previously described [2]. SCCmec types were assigned based on combinations of ccr (ccrA1-3, ccrB1-4, and ccrC) and mec gene complexes [2,24]. For spa typing, the spa repeat regions were PCR-amplified and sequenced to examine the tandem repeats, and spa types were determined in each MRSA isolate based on the SpaServer database (http://spa.ridom.de/) [29]. The agr types (I-IV) of MRSA isolates were assinged through a PCR-based method, as described previously [29].

In vitro susceptibility assays to cationic antimicrobial peptides

Three different HD-CAPs of LL-37, PMAP-36, and CATH-2 origin were used to assess the genotype- and host-specific susceptibility patterns of MRSA isolates to LL-37 [30], PMAP-36 (porcine myeloid antimicrobial peptide) [31], and CATH-2, respectively [32]. Human cathelicidin LL-37 ([LL-37, 37 aa]) was obtained from Peptide International (Louisville, KY, USA). PMAP-36 (GRFRRLRK KTRKRLKKIGKVLKWIPPIVGSIPLGCG) and CATH-2 (RFGRFLRKIRRFR PKVT ITIQGSARF) were synthesized at GL Biochem, Shanghai, China with a purity of >90%. Based on the manufacturer’ analytical data such as reverse-phase high performance liquid chromatography (HPLC) or MALDI-TOF mass spectrometry (MS), lyophilized peptides were resuspended in phosphate-buffered saline (PBS), aliquoted, and stored at −20°C.

In vitro susceptibility assays to LL-37, PAMP-36, and CATH-2 were performed as previously described using RPMI medium (Sigma-Aldrich, St. Louis, MO, USA) supplemented with 10% Luria-Bertani (LB) broth [33]. Briefly, overnight cultures of S. aureus cells grown in Tris buffered saline (TBS) were collected, washed two times with RPMI media, and then adjusted to ~1 × 104 CFU/mL in the RPMI containing 10% LB broth. Next, a final S. aureus inoculum of ~5 × 103 CFUs was incubated at 37°C in the presence of LL-37 (10 mg/mL), PMAP-36 (1.0 mg/mL), or CATH-2 (0.5 mg/mL). After 3 h incubation with peptides, aliquots (0.1 mL) of samples were processed for quantification of surviving bacterial cells (CFU/mL) by plating 10-fold serial dilutions of each culture on TSA plates. The peptide concentrations were adopted from extensive preliminary assays showing their inability to completely eliminate the viability of the initial bacterial inocula over the 3-h experiment period. Data are shown as the mean % of surviving MRSA CFUs ± SDs of cathelicidin-exposed versus unexposed bacterial cells. Three independent experiments were performed in triplicates for each MRSA isolate.

Measurement of net surface positive charge

To assess the relative staphylococcal cell surface positive charge that can affect susceptibility to HD-CAPs, cytochrome c binding assays were carried out on the 45 MRSA strains as described before [34,35]. Briefly, MRSA isolates were grown overnight (16–18 h) in TSB, washed twice with 20 mM morpholinepropanesulfonic acid (MOPS, pH 7.0) buffer, and resuspended in MOPS at an optical density (OD)600nm of 1.0. Staphylococcal cells were then incubated with 50 μg/mL of cytochrome c (Sigma-Aldrich) for 15 min at room temperature. Next, the reaction mixture was centrifuged (10,000×g) for 1 min to pellet the bacterial cells, and the quantity of free cytochrome c that remained in the supernatant was determined by measuring the OD530nm. A higher concentration of unbound cytochrome c in the supernatant corresponds to a more positively charged staphylococcal cell surface [36]. Three independent experiments were performed for each MRSA isolate.

Determination of carotenoid production

MRSA isolates were cultured in TSB to the stationary growth phase (24 h) at 37°C with shaking at 200 rpm to quantify carotenoid production. After incubation, staphylococcal cells were pelleted, washed three times with PBS, and then diluted in PBS to ~1.0×109 CFU/mL. The carotenoid contents of the MRSA isolates were collected using the methanol extraction method as previously described [37], and then quantified spectrophotometrically by measuring the OD462nm. At least three independent assays for carotenoid quantification were performed for all MRSA isolates.

In vitro hydrogen peroxide susceptibility assays

Susceptibility to hydrogen peroxide was determined as previously described by Liu et al. [38]. Briefly, ~2.0×109 CFUs of MRSA isolates were incubated with H2O2 (1.5% final concentration) at 37°C for 2 h, and catalase (1,000 U/mL, Sigma-Aldrich) was added to remove residual H2O2. Ten-fold dilutions were then prepared and placed on TSA plates for the enumeration of surviving staphylococcal cells. Data are expressed as the mean % of surviving CFU ± SDs of H2O2-treated versus untreated cells.

Statistical analysis

The quantitative data obtained in this study were analyzed for statistical significance using the Kruska-Wallis analysis of variance (ANOVA) test with the Tukey post hoc correction for multiple comparisons. Statistical significance of experimental data was set at p values < 0.05.

RESULTS

Genotypic profiles of MRSA isolates

A total of 45 MRSA isolates derived from humans (n = 19), pigs (n = 14), and chickens (n = 12) were used in this study (Table 1). All human and pig isolates were selected from previous studies [11,22,23]: eight isolates of ST5 HA-MRSA-II, eleven isolates of ST72 CA-MRSA-IV, eight isolates of ST398 LA-MRSA-V, and six isolates of ST541 LA-MRSA-V. As shown in Table 1, MLST analyses revealed that 12 chicken-associated MRSA isolates were ST692 LA-MRSA-V and six ST188 LA-MRSA-IV. Except for eight ST5 HA-MRSA-II isolates, which belonged to agr type II, all other 37 MRSA isolates were agr type I.

As presented in Table 1, three (t002, t2460, and t601) and five (t324, t13921, t664, t2461, and t148) different types of spa were identified in ST5 HA-MRSA-II and ST72 CA-MRSA-IV isolates, respectively. Unlike the various spa types observed in CA-MRSA and HA-MRSA isolates, all animal isolates tended to have ST-type-specific spa sequences. Except for one ST398 LA-MRSA (t571), the other ST398 LA-MRSA isolates belonged to t18102 or t18103. All six ST541 LA-MRSA isolates belonged to spa type t034. The chicken-derived ST692 and ST188 LA-MRSA isolate groups belonged to t2247 and t189, respectively (Table 1).

Antimicrobial resistance profiles of MRSA isolates

In general, the antimicrobial resistance patterns of MRSA strains differed depending on their ST and spa type. All LA-MRSA isolates showed MDR phenotypes to three or more subclasses of antimicrobial agents (Table 1). In particular, three isolates of ST398 LA-MRSA-V with spa type t18103 displayed the highest level of MDR (> 8 subclasses of antibiotic agents). In contrast to human-associated MRSA isolates (ST5 and ST72 MRSA isolates), all MRSA isolates of livestock origin (ST398, ST541, ST692, and ST188 MRSA isolates) were resistant to tetracycline. Interestingly, three ST types (ST398, ST692, and ST188) of LA-MRSA strains were resistant to ciprofloxacin, whereas all six ST541 LA-MRSA strains were susceptible to ciprofloxacin. In agreement with previous reports [39], ST5 HA-MRSA strains displayed higher levels of MDR than ST72 CA-MRSA isolates.

When grouped into six different STs (ST5, ST72, ST398, ST541, ST692, and ST188) of strain groups, the ST5 HA-MRSA strains had the highest oxacillin MIC values (512 mg/mL), followed by ST692 LA-MRSA (32–256 mg/mL), ST188 LA-MRSA (128 mg/mL), ST72 CA-MRSA (32–64 mg/mL), ST541 LA-MRSA (16–32 mg/mL), and ST398 LA-MRSA (4–24 mg/mL) (Table 1).

In vitro susceptibilities to human cathelicidin (LL-37), pig cathelicidin (PMAP-36), and chicken cathelicidin (CATH-2)

To assess the potential genotype-specific differences in susceptibility to HD-CAPs of human and animal origins among the six ST groups of MRSA isolates, in vitro 2-h survival assays were carried out for all 45 MRSA isolates against LL-37 (10 μg/mL), PMAP-36 (1.0 μg/mL), or CATH-2 (0.5 μg/mL). Interestingly, the ST5 HA-MRSA, ST692 LA-MRSA, and ST188 LA-MRSA isolates exhibited overall higher survival profiles against LL-37 than the ST72 CA-MRSA, ST398 LA-MRSA, and ST541 LA-MRSA isolates (Fig. 1A). The two STs of chicken origin, ST692 and ST188 MRSA isolates, displayed similar survival levels against LL-37. However, human- and pig-associated MRSA isolates exhibited significantly different levels of resistance to LL-37 between the two host-specific ST types (ST5 MRSA > ST72 MRSA, p < 0.01; ST398 > ST541 LA-MRSA isolates, p < 0.05).

jast-64-3-515-g1
Fig. 1. Susceptibility profiles of the different ST groups of MRSA strains to LL-37 (A), PMAP-36 (B), and CATH-2 (C). MRSA strains were exposed to LL-37 (10 μg/mL), PMAP-36 (1.0 μg/mL), and CATH-2 (0.5 μg/mL) and viability of the bacterial cells were determined. Data represent the means ± standard deviation of three independent experiments. Different letters indicate significant differences between the groups. ST, sequence type; MRSA, methicillin-resistant Staphylococcus aureus; LL-37, cathelicidin of humans; PMAP-36, cathelicidin of pigs; CATH-2, cathelicidin of chickens.
Download Original Figure

Susceptibility assays to PMAP-36 revealed that pig-associated LA-MRSA isolates were significantly more resistant to porcine cathelicidin than the human-associated or chicken-associated MRSA isolates (p < 0.01) (Fig. 1B). Although there were no significant differences in susceptibility to PMAP-36 between the two STs of LA-MRSA isolates (ST398 versus ST541 or ST692 versus ST188), ST5 HA-MRSA isolates exhibited significantly higher survival than ST72 CA-MRSA isolates (p < 0.01).

As shown in Fig. 1C, similar to the host-specific resistance to PMAP-36 observed in ST398 LA-MRSA strains isolated from pigs, ST692 LA-MRSA strains derived from chickens showed the highest level of resistance to the CATH-2 among the six ST groups of MRSA isolates. In contrast, ST188 LA-MRSA displayed significantly lower levels of resistance to CATH-2 than the ST692 LA-MRSA strains (p < 0.01). The two groups of swine-associated MRSA strains, ST398 LA-MRSA and ST541 LA-MRSA, showed the lowest levels of resistance to the CATH-2 peptide compared to the human- and chicken-associated MRSA strains (Fig. 1C).

Surface positive charge of MRSA isolates

Cytochrome c binding assays revealed that ST5 HA-MRSA and ST188 LA-MRSA had the highest net surface positive charge levels among the six ST groups of MRSA strains (Fig. 2). Unlike the human- and chicken-associated MRSA isolates, which exhibited significant differences between ST5 HA-MRSA and ST72 CA-MRSA (p < 0.05) or ST692 vs. ST188 LA-MRSA (p < 0.01), swine-associated LA-MRSA isolates did not show significant differences in cell surface charge between the ST398 and ST541 MRSA groups.

jast-64-3-515-g2
Fig. 2. Cytochrome c binding assays to measure comparative surface positive charges of MRSA strains. These data represent means ± SD of three independent experiments. *p < 0.05, **p < 0.01. ST, sequence type; MRSA, methicillin-resistant Staphylococcus aureus.
Download Original Figure
Measurement of carotenoid production

Quantification of carotenoid production in all 45 MRSA strains revealed that ST5 HA-MRSA and ST188 LA-MRSA strains exhibited the highest carotenoid content among the six different ST groups (Fig. 3). When the strain groups were compared within their host species, ST5 HA-MRSA, ST398 LA-MRSA, and ST188 LA-MRSA showed significantly higher levels of carotenoid production than the ST72 CA-MRSA, ST541 LA-MRSA, and ST692 LA-MRSA strains (p < 0.05).

jast-64-3-515-g3
Fig. 3. Measurement of staphyloxanthin production in different ST groups of MRSA strains. Bars represent the means ± SD of three independent experiments. *p < 0.05, **p < 0.01. OD, optical density; ST, sequence type; MRSA, methicillin-resistant Staphylococcus aureus.
Download Original Figure
Susceptibility to hydrogen peroxide

As shown in Fig. 4, in vitro H2O2 susceptibility assays over a 2-h period revealed that the ST5 HA-MRSA and ST398 LA-MRSA strain groups exhibited significantly higher survival in the presence of 1.5% H2O2 than that of ST72 HA-MRSA and ST541 LA-MRSA strains (p < 0.05). In contrast, there was no significant difference in the mean survival against H2O2 between the two chicken-derived MRSA strains, ST188 and ST692. Of note, ST5 HA-MRSA strains showed the highest level of resistance to H2O2 among the six different ST groups.

jast-64-3-515-g4
Fig. 4. Survival of different ST groups of MRSA strains against hydrogen peroxide. MRSA cells (~2.0×109 CFUs) were incubated with H2O2 (1.5% final concentration) at 37°C for 2 h and surviving bacterial cells were enumerated on TSA plates. Bars represent the mean % of surviving CFU ± SDs of H2O2-treated versus untreated cells. *p < 0.05, **p < 0.01. ST, sequence type; MRSA, methicillin-resistant Staphylococcus aureus.
Download Original Figure

DISCUSSION

MRSA is an important human and animal pathogen that can cause frequent and often life-threatening infections in both community and hospital settings [4,40]. However, the mechanisms involved in the transmission of human- or animal-adapted MRSA strains to new host species remain poorly understood. One of the critical components in host defense against MRSA infections involves innate immune responses, including HD-CAPs such as cathelicidins [41–43]. Since MRSA infections in human and animal hosts are caused mainly by colonizing strains of staphylococci [3,44], the pathogen needs to deploy survival and adaptation mechanisms against the cathelicidins of human and animal hosts.

It has been shown that certain clonal lineages of MRSA strains are found in limited numbers of animal species or geographical regions [1,6,10]. Some recent studies have reported that ST72-MRSA-IV and ST5-MRSA-II represent major community and hospital MRSA clones in Korea, respectively [7–9]. In addition to the human-adapted MRSA clones, several major LA-MRSA clones have been recognized in livestock animals and meat production chains in Korea. The nationwide spread and prevalence of ST398-MRSA-V and ST541-MRSA-V in pigs and pork production systems in Korea have been demonstrated in several previous studies [11,13,14,16]. Furthermore, ST692 and ST188 LA-MRSA strains have also been isolated from chicken and chicken meat production chains in Korea [15,16,21]. The two groups of chicken-derived LA-MRSA clones used in this study were ST692-MRSA-V with spa type t2247 and ST188-MRSA-IV with spa type t189 (Table 1).

Both host and bacterial factors may play critical roles in the adaptation and transmission of MRSA within or between human and animal hosts [19,40,45]. In this regard, one of the crucial innate immune responses of human and animal hosts against newly colonizing MRSA strains is HD-CAPs, especially cathelicidins. A previous report from our laboratory revealed that ST5 HA-MRSA-II tended to show higher resistance to LL-37 and bovine myeloid antimicrobial peptide-28 (BMAP-28), suggesting a potential role of cathelicidin resistance in enhancing the virulence and mortality of ST5 HA-MRSA-II [22]. In line with these observations, ST5 HA-MRSA-II displayed significantly higher levels of resistance against LL-37 and PMAP-36 origins than the ST72 CA-MRSA-IV strains (Figs. 1A and 1B). The two chicken-derived LA-MRSA clones, ST692 and ST188 LA-MRSA, displayed higher levels of resistance to LL-37 andthan the ST72, ST398, and ST541 MRSA strains (p < 0.01), while ST398 and ST541 exhibited the highest levels of resistance to the porcine cathelicidin PMAP-36 (p < 0.01). Besides being prevalent in poultry farms, ST188 MRSA strains have been recognized as major CA-MRSA in Australis and China [46,47]. ST692 MRSA has also been identified in slaughterhouse workers in Korea [16], indicating that the higher levels of resistance to LL-37 in ST188 and ST692 MRSA may help to colonize human host. The observation that ST692 MRSA isolates are significantly more resistant to CATH-2 than ST188 MRSA isolates is likely to be correlated with the higher prevalence of the ST692 in chicken farms in Korea [15]. ST398 MRSA has been isolated from pigs and pig farm environment in many countries including Korea [5,7,10,11,13]. Of note, the clonal lineage of ST541 MRSA has been detected in healthy pigs in Korea [11]. As shown in Fig. 1B, ST398 and ST541 MRSA isolates were more resistant to the cathelicidin of pig origin (PAMP-36), correlating with previous reports of predominant colonization of pigs with CC398 (ST398 and ST541) strains. However, significantly enhanced LL-37 resistance in ST398 might be associated with higher prevalence of ST398 versus ST541 MRSA strains [11]. Overall, these data indicated that MRSA strains of human or animal origin tended to show enhanced levels of resistance to the cathelicidins of the same host species from which they were derived.

Several recently published reports have demonstrated that the HD-CAP resistance phenotype in staphylococci is associated with physicochemical alterations in the cell membrane, such as increased net cell surface positive charge, altered cell membrane fluidity, and fatty acid composition [48–51]. Consistent with previously published data, the ST5 HA-MRSA-II strains exhibited an enhanced net surface positive charge than the ST72 CA-MRSA-IV strains [22], indicating that the increased net surface positive charge in the ST5 HA-MRSA-II strains contributed to the enhanced resistance to cathelicidins (Fig. 2). However, although the pig-derived LA-MRSA strains exhibited the highest level of resistance to PMAP-36 (Fig. 1B), these two ST groups (ST398 and ST541) had lower levels of net surface positive charge than the human (ST5)- and chicken-derived (ST692 and ST188) MRSA strains (Fig. 2). The ST188 MRSA strains also showed significantly elevated surface positive charges compared to the ST692 MRSA strains (p < 0.01), correlating with the LL-37 resistance phenotype (Fig. 1A), but not with CATH-2 resistance (Fig. 1C). The enhanced surface positive charge in S. aureus has been associated with altered expression/sequence variation of dltABCD, mprF, and graRS genes [34,35,48]. In addition, degree of O-acetylation in peptidoglycan cell wall has been proposed to be involved in antimicrobial peptide resistance via surface positive charge regulation in S. aureus [48]. These additional factors affecting surface positive charge in S.aureus need to be addressed in future studies. Moreover, aside from the surface positive charge, cell envelope perturbations such as celll membrane fluidity, altered cell membrane permeabilization by cathelicidins, and staphylococcal memebrane fatty acid composition need to be evaluated. Based on the results, it is likely that there are multiple mechanisms involved in the host- and clonotype-specific cathelicidin resistance profiles of MRSA strains in addition to the net cell surface positive charge, especially for LA-MRSA strains of chicken and pig origins.

Carotenoid pigmentation in S. aureus has been shown to affect cell membrane fluidity and counteract oxidative host defense mechanisms. It has been demonstrated that increased carotenoid biosynthesis could contribute to HD-CAP resistance in S. aureus by decreasing cell membrane fluidity [51]. In agreement with previous reports [22], ST5 HA-MRSA strains with enhanced resistance to the three cathelicidins (Figs. 1A, 1B, and 1C) exhibited significantly increased levels of carotenoid production compared to the ST72 CA-MRSA strains (Fig. 3). In addition, correlating with the LL-37 resistance profiles (Fig. 1A), the ST5 HA-MRSA and ST188 LA-MRSA strains produced significantly higher carotenoid contents than the other four groups of MRSA strains (p < 0.05). Enhanced carotenoid production in S. aureus has previously been linked to enhanced resistance to human antimicrobial peptides and cell wall targeting antimicrobial agents [18]. However, although the pig-associated LA-MRSA strains (ST398 and ST541) exhibited the highest levels of resistance to PMAP-36 (Fig. 1B), these strain groups did not produce higher levels of carotenoids than the ST5, ST72, and ST188 strain groups (Fig. 3), indicating that changes in cell membrane fluidity via carotenoid production have a very limited impact on the PMAP-36 resistance phenotype in ST398 and ST541 strains. Furthermore, the significant difference in carotenoid production observed between ST692 and ST188 LA-MRSA strain groups did not correlate with a higher level of CATH-2 resistance in the ST692 strain group versus the ST188 strain group (Fig. 1C). Collectively, these results suggest that human-type MRSA and LA-MRSA strains deploy different strategies to counteract the bactericidal activity of HD-CAPs encountered during host adaptation and colonization.

Given the impact of carotenoid production on the antioxidant activity of MRSA against the host innate immune response [38,52,53], in vitro susceptibility to H2O2 was determined for the six clonotypes of MRSA strains. Consistent with the carotenoid pigmentation profiles (Fig. 3), the ST5 HA-MRSA and ST398 LA-MRSA strain groups exhibited significantly higher levels of resistance to H2O2 than the ST72 CA-MRSA and ST541 LA-MRSA strains, respectively (Fig. 4). Although the results failed to reach statistical significance in resistance to H2O2, higher levels of carotenoid production in ST188 MRSA strains were also correlated with the moderate increase in H2O2 resistance compared to the ST692 strains. In a previous study it has been suggested that the carriage of superantigen genes in ST5 HA-MRSA may play a role in the higher virulence versus ST72 CA-MRSA [54]. Based on our result it is likely that enhanced resistance to HD-CAPs and H2O2 via increased surface positive charge and carotenoid production also contribute to the higher virulence of ST5 HA-MRSA versus ST72 CA-MRSA strains. Recently, ST188 S. aureus has been identified as a major clonal lineage causing infections in multiple host species in China [47]. Whole genome sequence analyses revealed that ST188 S. aureus strains can be transmitted more easily among different host species [47]. The higer level of LL-37 resistance (Fig. 1A), enhanced surface positive charge (Fig. 2) and higher carotenoid production in ST188 MRSA strains (Fig. 3) versus ST692 MRSA strains may help to colonize diverse host species. On the contrary, the highest level of CATH-2 resistance observed in ST692 MRSA strains may be linked to the prevalence of this lineage in chickens [15].

In conclusion, the results of the present investigation suggest that: (i) there are differences in the biological activities of human- and animal-derived cathelicidins against MRSA strains of human (ST72 CA-MRSA and ST5 HA-MRSA), pig (ST398 and ST541 LA-MRSA), and chicken (ST692 and ST188 LA-MRSA) origins; (ii) ST5 HA-MRSA strains have higher resistance to various types of cathelicidins than ST72 CA-MRSA strains, as correlated with an increased net surface positive charge, enhanced production of carotenoid pigments, and enhanced resistance to H2O2; (iii) in contrast to human-type MRSA strains, pig- and chicken-associated MRSA strains had cathelicidin resistance mechanisms other than surface positive charge regulation and carotenoid production; and (iv) clonotype-specific cathelicidin resistance profiles may contribute to increased virulence or adaptation within new host species. To the best of our knowledge, this study is the first to evaluate potential role of HD-CAP resistance in human and animal host adaptation of MRSA strains.

Competing interests

No potential conflict of interest relevant to this article was reported.

Funding sources

This study was supported by a grant (NRF-2019R1F1A1058397) from Basic Science Research Program through the National Research Foundation of Korea funded by the Ministry of Education.

Acknowledgements

Not applicable.

Availability of data and material

Upon reasonable request, the datasets of this study can be available from the corresponding author.

Authors’ contributions

Conceptualization: Kim SD, Kim GB, Yang SJ.

Data curation: Kim SD, Yang SJ.

Formal analysis: Kim SD, Yang SJ.

Methodology: Kim SD, Lee GY.

Validation: Yang SJ.

Investigation: Kim SD, Lee GY, Yang SJ.

Writing - original draft: Kim SD, Kim GB, Yang SJ.

Writing - review & editing: Kim SD, Kim GB, Lee GY, Yang SJ.

Ethics approval and consent to participate

This article does not require IRB/IACUC approval because there are no human and animal participants.

REFERENCES

1.

Boswihi SS, Udo EE. Methicillin-resistant Staphylococcus aureus: an update on the epidemiology, treatment options and infection control. Curr Med Res Pract. 2018; 8:18-24

2.

Kondo Y, Ito T, Ma XX, Watanabe S, Kreiswirth BN, Etienne J, et al. Combination of multiplex PCRs for staphylococcal cassette chromosome mec type assignment: rapid identification system for mec, ccr, and major differences in junkyard regions. Antimicrob Agents Chemother. 2007; 51:264-74

3.

Davis KA, Stewart JJ, Crouch HK, Florez CE, Hospenthal DR. Methicillin-resistant Staphylococcus aureus (MRSA) nares colonization at hospital admission and its effect on subsequent MRSA infection. Clin Infect Dis. 2004; 39:776-82

4.

Gould IM. The clinical significance of methicillin-resistant Staphylococcus aureus. J Hosp Infect. 2005; 61:277-82

5.

Lakhundi S, Zhang K. Methicillin-resistant Staphylococcus aureus: molecular characterization, evolution, and epidemiology. Clin Microbiol Rev. 2018; 31e00020-18

6.

Stefani S, Chung DR, Lindsay JA, Friedrich AW, Kearns AM, Westh H, et al. Meticillin-resistant Staphylococcus aureus (MRSA): global epidemiology and harmonisation of typing methods. Int J Antimicrob Agents. 2012; 39:273-82

7.

Kang GS, Jung YH, Kim HS, Lee YS, Park C, Lee KJ, et al. Prevalence of major methicillin-resistant Staphylococcus aureus clones in Korea between 2001 and 2008. Ann Lab Med. 2016; 36:536-41

8.

Park SY, Chung DR, Yoo JR, Baek JY, Kim SH, Ha YE, et al. Sequence type 72 community-associated meticillin-resistant Staphylococcus aureus emerged as a predominant clone of nasal colonization in newly admitted patients. J Hosp Infect. 2016; 93:386-9

9.

Yang E, Kim E, Chung H, Lee YW, Bae S, Jung J, et al. Changing characteristics of S. aureus bacteremia caused by PVL-negative, MRSA strain over 11 years. Sci Rep. 2021; 11:1567

10.

Aires-de-Sousa M. Methicillin-resistant Staphylococcus aureus among animals: current overview. Clin Microbiol Infect. 2017; 23:373-80

11.

Back SH, Eom HS, Lee HH, Lee GY, Park KT, Yang SJ. Livestock-associated methicillin-resistant Staphylococcus aureus in Korea: antimicrobial resistance and molecular characteristics of LA-MRSA strains isolated from pigs, pig farmers, and farm environment. J Vet Sci. 2020; 21e2

12.

Golding GR, Bryden L, Levett PN, McDonald RR, Wong A, Wylie J, et al. Livestock-associated methicillin-resistant Staphylococcus aureus sequence type 398 in humans, Canada. Emerg Infect Dis. 2010; 16:587

13.

Lim SK, Nam HM, Jang GC, Lee HS, Jung SC, Kwak HS. The first detection of methicillin-resistant Staphylococcus aureus ST398 in pigs in Korea. Vet Microbiol. 2012; 155:88-92

14.

Moon DC, Jeong SK, Hyun BH, Lim SK. Prevalence and characteristics of methicillin-resistant Staphylococcus aureus isolates in pigs and pig farmers in Korea. Foodborne Pathog Dis. 2019; 16:256-61

15.

Lim SK, Nam HM, Park HJ, Lee HS, Choi MJ, Jung SC, et al. Prevalence and characterization of methicillin-resistant Staphylococcus aureus in raw meat in Korea. J Microbiol Biotechnol. 2010; 20:775-8

16.

Moon DC, Tamang MD, Nam HM, Jeong JH, Jang GC, Jung SC, et al. Identification of livestock-associated methicillin-resistant Staphylococcus aureus isolates in Korea and molecular comparison between isolates from animal carcasses and slaughterhouse workers. Foodborne Pathog Dis. 2015; 12:327-34

17.

Hancock REW, Sahl HG. Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nat Biotechnol. 2006; 24:1551-7

18.

Kubicek-Sutherland JZ, Lofton H, Vestergaard M, Hjort K, Ingmer H, Andersson DI. Antimicrobial peptide exposure selects for Staphylococcus aureus resistance to human defence peptides. J Antimicrob Chemother. 2017; 72:115-27

19.

Quinn GA, Cole AM. Suppression of innate immunity by a nasal carriage strain of Staphylococcus aureus increases its colonization on nasal epithelium. Immunology. 2007; 122:80-9

20.

Zanger P, Nurjadi D, Vath B, Kremsner PG. Persistent nasal carriage of Staphylococcus aureus is associated with deficient induction of human β-defensin 3 after sterile wounding of healthy skin in vivo. Infect Immun. 2011; 79:2658-62

21.

Agier J, Efenberger M, Brzezińska-Błaszczyk E. Cathelicidin impact on inflammatory cells. Cent Eur J Immunol. 2015; 40:225-35

22.

Kang KM, Park JH, Kim SH, Yang SJ. Potential role of host defense antimicrobial peptide resistance in increased virulence of health care-associated MRSA strains of sequence type (ST) 5 versus livestock-associated and community-associated MRSA strains of ST72. Comp Immunol Microbiol Infect Dis. 2019; 62:13-8

23.

Nam EY, Yang SJ, Kim ES, Cho JE, Park KH, Jung SI, et al. Emergence of daptomycin-nonsusceptible methicillin-resistant Staphylococcus aureus clinical isolates among daptomycin-naive patients in Korea. Microb Drug Resist. 2018; 24:534-41

24.

Geha DJ, Uhl JR, Gustaferro CA, Persing DH. Multiplex PCR for identification of methicillin-resistant staphylococci in the clinical laboratory. J Clin Microbiol. 1994; 32:1768-72

25.

CLSI [Clinical and Laboratory Standards Institute]. Performance standards for antimicrobial susceptibility testing. 28th ed Wayne, PA: CLSI. 2018

26.

NCCLS [National Committee for Clinical Laboratory Standards]. Performance standards for antimicrobial disk and dilution susceptibility tests for bacteria isolated from animals: approved standard. 2nd ed Wayne, PA: NCCLS. 2002

27.

CLSI [Clinical and laboratory standards institute]. Performance standards for antimicrobial susceptibility testing. Wayne, PA: CLSI. 2011

28.

Enright MC, Day NPJ, Davies CE, Peacock SJ, Spratt BG. Multilocus sequence typing for characterization of methicillin-resistant and methicillin-susceptible clones of Staphylococcus aureus. J Clin Microbiol. 2000; 38:1008-15

29.

Gilot P, Lina G, Cochard T, Poutrel B. Analysis of the genetic variability of genes encoding the RNA III-activating components Agr and TRAP in a population of Staphylococcus aureus strains isolated from cows with mastitis. J Clin Microbiol. 2002; 40:4060-7

30.

Vandamme D, Landuyt B, Luyten W, Schoofs L. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cell Immunol. 2012; 280:22-35

31.

Zhang G, Ross CR, Blecha F. Porcine antimicrobial peptides: new prospects for ancient molecules of host defense. Vet Res. 2000; 31:277-96

32.

Cuperus T, Coorens M, van Dijk A, Haagsman HP. Avian host defense peptides. Dev Comp Immunol. 2013; 41:352-69

33.

Xiong YQ, Mukhopadhyay K, Yeaman MR, Adler-Moore J, Bayer AS. Functional interrelationships between cell membrane and cell wall in antimicrobial peptide-mediated killing of Staphylococcus aureus. Antimicrob Agents Chemother. 2005; 49:3114-21

34.

Meehl M, Herbert S, Götz F, Cheung A. Interaction of the GraRS two-component system with the VraFG ABC transporter to support vancomycin-intermediate resistance in Staphylococcus aureus. Antimicrob Agents Chemother. 2007; 51:2679-89

35.

Peschel A, Otto M, Jack RW, Kalbacher H, Jung G, Götz F. Inactivation of the dlt operon in Staphylococcus aureus confers sensitivity to defensins, protegrins, and other antimicrobial peptides. J Biol Chem. 1999; 274:8405-10

36.

Hamilton A, Popham DL, Carl DJ, Lauth X, Nizet V, Jones AL. Penicillin-binding protein 1a promotes resistance of group B streptococcus to antimicrobial peptides. Infect Immun. 2006; 74:6179-87

37.

Yang Y, Wang H, Zhou H, Hu Z, Shang W, Rao Y, et al. Protective effect of the golden staphyloxanthin biosynthesis pathway on Staphylococcus aureus under cold atmospheric plasma treatment. Appl Environ Microbiol. 2020; 86e01998-19

38.

Liu GY, Essex A, Buchanan JT, Datta V, Hoffman HM, Bastian JF, et al. Staphylococcus aureus golden pigment impairs neutrophil killing and promotes virulence through its antioxidant activity. J Exp Med. 2005; 202:209-15

39.

Kim ES, Song JS, Lee HJ, Choe PG, Park KH, Cho JH, et al. A survey of community-associated methicillin-resistant Staphylococcus aureus in Korea. J Antimicrob Chemother. 2007; 60:1108-14

40.

Kong EF, Johnson JK, Jabra-Rizk MA. Community-associated methicillin-resistant Staphylococcus aureus: an enemy amidst us. PLoS Pathog. 2016; 12e1005837

41.

van Dijk A, Molhoek EM, Bikker FJ, Yu PL, Veldhuizen EJA, Haagsman HP. Avian cathelicidins: paradigms for the development of anti-infectives. Vet Microbiol. 2011; 153:27-36

42.

Zanetti M. Cathelicidins, multifunctional peptides of the innate immunity. J Leukoc Biol. 2004; 75:39-48

43.

Zasloff M. Antimicrobial peptides of multicellular organisms. Nature. 2002; 415:389-95

44.

Muder RR, Brennen C, Wagener MM, Vickers RM, Rihs JD, Hancock GA, et al. Methicillin-resistant staphylococcal colonization and infection in a long-term care facility. Ann Intern Med. 1991; 114:107-12

45.

Zhu S, Gao B. Positive selection in cathelicidin host defense peptides: adaptation to exogenous pathogens or endogenous receptors?. Heredity. 2017; 118:453-65

46.

Nimmo GR, Coombs GW. Community-associated methicillin-resistant Staphylococcus aureus (MRSA) in Australia. Int J Antimicrob Agents. 2008; 31:401-10

47.

Wang Y, Liu Q, Liu Q, Gao Q, Lu H, Meng H, et al. Phylogenetic analysis and virulence determinant of the host-adapted Staphylococcus aureus lineage ST188 in China. Emerg Microbes Infect. 2018; 7:1-11

48.

Bayer AS, Mishra NN, Chen L, Kreiswirth BN, Rubio A, Yang SJ. Frequency and distribution of single-nucleotide polymorphisms within mprF in methicillin-resistant Staphylococcus aureus clinical isolates and their role in cross-resistance to daptomycin and host defense antimicrobial peptides. Antimicrob Agents Chemother. 2015; 59:4930-7

49.

Joo HS, Fu CI, Otto M. Bacterial strategies of resistance to antimicrobial peptides. Philos Trans R Soc Lond B Biol Sci. 2016; 371:20150292

50.

Kraus D, Peschel A. Molecular mechanisms of bacterial resistance to antimicrobial peptides. Curr Top Microbiol Immunol. 2006; 306:231-50

51.

Mishra NN, Liu GY, Yeaman MR, Nast CC, Proctor RA, McKinnell J, et al. Carotenoid-related alteration of cell membrane fluidity impacts Staphylococcus aureus susceptibility to host defense peptides. Antimicrob Agents Chemother. 2011; 55:526-31

52.

Clauditz A, Resch A, Wieland KP, Peschel A, Götz F. Staphyloxanthin plays a role in the fitness of Staphylococcus aureus and its ability to cope with oxidative stress. Infect Immun. 2006; 74:4950-3

53.

Liu CI, Liu GY, Song Y, Yin F, Hensler ME, Jeng WY, et al. A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence. Science. 2008; 319:1391-4

54.

Park KH, Chong YP, Kim SH, Lee SO, Choi SH, Lee MS, et al. Community-associated MRSA strain ST72-SCCmecIV causing bloodstream infections: clinical outcomes and bacterial virulence factors. J Antimicrob Chemother. 2015; 70:1185-92